Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 3 (CERS3)

This Recombinant Human Ceramide synthase 3 (CERS3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Ceramide synthase 3, CerS3, LAG1 longevity assurance homolog 3

UniProt

Q8IU89

Expression Region

1-383

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFV ASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSR RNQERPSRLKKFQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYW YYILEMSFYWSLLFRLGFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDV ADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGK EMDCLKNGLRAERHLIPNGQHGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VLDL Receptor/VLDLR Antibody Picoband®, PE Conjugate
A02195-1-PE 100 µg/Vial

Anti-VLDL Receptor/VLDLR Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
PODXL2 Protein, Mouse, Recombinant (His)
TMPK-01088-01 5 µg

PODXL2 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
PODXL2 Protein, Mouse, Recombinant (His)
TMPK-01088-02 10 µg

PODXL2 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
PODXL2 Protein, Mouse, Recombinant (His)
TMPK-01088-03 20 µg

PODXL2 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
PODXL2 Protein, Mouse, Recombinant (His)
TMPK-01088-04 50 µg

PODXL2 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
PODXL2 Protein, Mouse, Recombinant (His)
TMPK-01088-05 100 µg

PODXL2 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details