Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 3 (CERS3)

This Recombinant Human Ceramide synthase 3 (CERS3) spans the amino acid sequence from region 1-383.

Product Specifications

Product Name Alternative

Ceramide synthase 3, CerS3, LAG1 longevity assurance homolog 3

UniProt

Q8IU89

Expression Region

1-383

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFWTFKEWFWLERFWLPPTIKWSDLEDHDGLVFVKPSHLYVTIPYAFLLLIIRRVFEKFV ASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLAKKCNLTERQVERWFRSR RNQERPSRLKKFQEACWRFAFYLMITVAGIAFLYDKPWLYDLWEVWNGYPKQPLLPSQYW YYILEMSFYWSLLFRLGFDVKRKDFLAHIIHHLAAISLMSFSWCANYIRSGTLVMIVHDV ADIWLESAKMFSYAGWTQTCNTLFFIFSTIFFISRLIVFPFWILYCTLILPMYHLEPFFS YIFLNLQLMILQVLHLYWGYYILKMLNRCIFMKSIQDVRSDDEDYEEEEEEEEEEATKGK EMDCLKNGLRAERHLIPNGQHGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBB Mouse Monoclonal Antibody
AMM81085-01 1 Each

UBB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
UBB Mouse Monoclonal Antibody
AMM81085-02 50 µL

UBB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
UBB Mouse Monoclonal Antibody
AMM81085-03 100 µL

UBB Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Extracto, Vacuum filtration system, 250ML0.22CA
EXVF0250BCA02AZS 12 Pieces/Case:1 Piece/ PACKS:12 PACKS/CASE

Extracto, Vacuum filtration system, 250ML0.22CA

Sign In for Pricing
View Details
Caspase-9 (ICE-LAP6, McL6, Apaf-3) (HRP) discontinued
214560-HRP 100 µL

Caspase-9 (ICE-LAP6, McL6, Apaf-3) (HRP) discontinued

Sign In for Pricing
View Details
Gm3604 Protein Vector (Mouse) (pPB-N-His)
PV183863 500 ng

Gm3604 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details