Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB)

This Recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B4UJU7

Expression Region

1-384

Origin

Anaeromyxobacter sp. (strain K)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAATLVTLALSLSLAQHDAAPAPAPAAVEQHGAAPEAAASADPHAAPAGEHGAAVEAHA AAAGEHGEAAGHEGGHDESLGAVMLHHVTDGYVIEHPGFCNGAFAWNCEWDLRATFGDAL KFGKLDLTPTKHVIMMWLASALLLVVVLAAVRKKSLVPRGLYNFIELLVAFVRNEIAVKN IGEKDADRFTPYLVTAFFFILFLNLFGLLPFSATATANLSVTVAMALFTFFITQYAAIRA MGMGGYVAHLTGGVPKSLAPLWLIMVPVEFLGLFTKPFALTVRLFANMLAGHFVILALLG LIFALGTPWVAFGSVPMALSIFLLELFVAFVQAYIFTMLSSLFIGAGLVHHGDDHGHAEE HGHAGPGMGSEHGSHVAGASPGHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-500 1x 500 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details