Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Zinc homeostasis factor 1 (zhf1)

This Recombinant Schizosaccharomyces pombe Zinc homeostasis factor 1 (zhf1) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Zinc homeostasis factor 1

UniProt

O13918

Expression Region

1-387

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDLARQTRIILLLGIDVTFFFIEIITGYAIDSLALIADSFHMLNDIVSLLVALWATRLA HSTSHEPKYTYGWQRAEILGALSNGVFLIALCMFIFMEAIERFIEPPSVSNPTLMFFVGS LGLLSNFVGIFLFHDHGHDHPHTHTAQNYDFPEEDDIESVLPSTIVHRCNTSQQEVSHTH TQVADSATESSPLLSYTGNHNGAGTSKPVNNHGSIEQDAPKQTKKRNLNMHGVFLHVLGD ALGNIGVISAALFIKYTDYSWRFLFDPCISILLTFIILFSAIPLCKSAALILLQVAPQSI KLDDVSNLINHLDGVESVHELHIWQLSDVKLIATVHVCVTLPDDKGESYTKLTTDIRNVL QSFGIYDVTIQPEFANHPLLCDQGSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-100 1x 100 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), CF647 conjugate, 0.1mg/mL
BNC470102-500 1x 500 µL

Golgi Complex (371-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF405S conjugate, 0.1mg/mL
BNC041409-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details