Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Zinc transporter 7 (slc30a7)

This Recombinant Danio rerio Zinc transporter 7 (slc30a7) spans the amino acid sequence from region 1-387.

Product Specifications

Product Name Alternative

Zinc transporter 7, ZnT-7, Solute carrier family 30 member 7

UniProt

A5PMX1

Expression Region

1-387

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPAKFNLVVKLSGWFRSILADKTSRNLFFFLCLNLSFAFVELLYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWRSNDSFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALEPPDVHHDRLLPVSIAGLLVNLVGIFVFQHGGHGHSHGGDDHGHSHSLF NGSAAHGHSHGGHGHSHGGHGHSHESKHGHDHGHSHGGHGHSHDDQHCHDDHTLTPGKGS SKQILQGVFLHIVADTLGSVGVIISAILMQKYDLMIADPICSMLIALLIGVSVVPLLRES IGILMQRTPPSLDHALPECYQRVQQLQGVYNLQEPHFWTLCTDVYIGTLKLLVAPDADSR WILSQTHNIFTQVGVRQLYVQIEVAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-100 1x 100 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CNN1/832), CF594 conjugate, 0.1mg/mL
BNC940832-500 1x 500 µL

Calponin-1 (CNN1/832), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details