Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Putative membrane protein MJ1562 (MJ1562)

This Recombinant Methanocaldococcus jannaschii Putative membrane protein MJ1562 (MJ1562) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Putative membrane protein MJ1562

UniProt

Q58957

Expression Region

1-388

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVLMLREILKKVAHFSEQKPFLMLLIILIITVFAGISATNVKSQTAFEKMLPQDNPIIK TLYEVRDEFGGTDVITICIKLKPSDSSDKVVDIRDPRVLKAIKELEDNLRYVDGITSVSS PVDIIIQKNNGIVPNDIDTVKDILNKLPEDKRKRIFNSDYSMTVVNAYTDAGGDQKKLMR VMDDVNERIEETPFPPGVEVIATGTPPMRKLMDELMKESQSFTTTVGLIGILIILIIYFR KPLSSIMPLLPVLIAVIWTGGAMGLLDIPLDMATAGIGSLILGLGIDYGIHLMHRYDEER RKGMPIDKAIETAVVETGTAVMATTATTVVGFLALVLAPLPMMANLGKVCALGISFCMVV VLTLLPALIVIEERHIMPLIKRLKGDTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details