Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 3 (Slc30a3)

This Recombinant Mouse Zinc transporter 3 (Slc30a3) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Zinc transporter 3, ZnT-3, Solute carrier family 30 member 3

UniProt

P97441

Expression Region

1-388

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPSLATGGSETTRLVSARDRSSAGGGLRLKSLFTEPSEPLPEEPKLEGMAFHHCHKDPV PQSGLSPERVQARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASL FSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAM LLTASIAVCANLLMAFVLHQTGAPHSHGSTGAEYAPLEEGHGYPMSLGNTSVRAAFVHVL GDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSV EFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRF GFSSCTLQVEQYQPEMAQCLRCQEPSQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Signal-induced proliferation-associated protein 1 (SIPA1) Elisa Kit
EK713709 96 Well

Human Signal-induced proliferation-associated protein 1 (SIPA1) Elisa Kit

Sign In for Pricing
View Details
SUMO2 Protein Vector (Mouse) (pPM-C-His)
PV235273 500 ng

SUMO2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LHX5 (LIM/Homeobox Protein Lhx5, LIM Homeobox Protein 5, MGC129689) (PE)
MBS6158612-01 0.1 mL

LHX5 (LIM/Homeobox Protein Lhx5, LIM Homeobox Protein 5, MGC129689) (PE)

Sign In for Pricing
View Details
LHX5 (LIM/Homeobox Protein Lhx5, LIM Homeobox Protein 5, MGC129689) (PE)
MBS6158612-02 5x 0.1 mL

LHX5 (LIM/Homeobox Protein Lhx5, LIM Homeobox Protein 5, MGC129689) (PE)

Sign In for Pricing
View Details
CCDC110 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15175062 1.0 µg DNA

CCDC110 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Human VWA3A Polyclonal Antibody
HT058014-01 50 µg

Anti-Human VWA3A Polyclonal Antibody

Sign In for Pricing
View Details