Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma capricolum subsp. capricolum Membrane protein insertase YidC (yidC)

This Recombinant Mycoplasma capricolum subsp. capricolum Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-388.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

P43042

Expression Region

1-388

Origin

Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYLNASKNKKAPKTKKEIFKVVIKWLKVFGFLFILVSMLWGCVQMYQAQYSVNQIVDMT GKSVYTPGVSFEIILSSLGEQGSKVHHFVYDKGSFFEYGYNAITSWKETFKLTQSPFYGF FVYPTAWILAGMIKLFSGTLNPLLDKSSQLTYGISSIFAIFLTTLLIKGITLSFGWKSQI NQEKMQDIQLKVADIQAKYKDKKDMQSKQKQQLEIQALYKKENMSQFSALAGSFAPLPFL FAIYAIVRSTRALKIASVGPIALIEGPWQQITAGNYIYIIILAIYLPLQAVSMLLPTLLQ MKKQKSITLTEAQKKSRKKQLIMQVVMMFVFIIIIVSVATGVCIYWIFSSILQIIQTYAF YLYNEKKRKAGNQERQRRLRQMERMNLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
BNC470460-100 1x 100 µL

CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details