Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Zinc transporter 7-B (slc30a7-b)

This Recombinant Xenopus laevis Zinc transporter 7-B (slc30a7-b) spans the amino acid sequence from region 1-390.

Product Specifications

Product Name Alternative

Zinc transporter 7-B, ZnT-7-B, Solute carrier family 30 member 7-B

UniProt

Q6NRI1

Expression Region

1-390

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPLSIKDDEYKPPKFNLVRKVSGWIRSIFSDSTSRNLFCFLCLNLSFAFVELFYGIWSN SLGLISDSFHMFFDCTALLAGLAASVISRWKTNETFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGIERALDTPEVHHERLLPVSIMGFLVNLIGIFVFQHGGGHGHSHESGHGHSHSLF NGAVSHGHSHSHGGGHGHSHGGGHEHGHSHGGGHEHGHDHSHKHGHGYGSSCHDEPPEEN KGSSKQILEGVFLHIVADALGSVGVIISTILMQQYGLMIADPICSMLIALLIFVSVIPLL KQSIGILMQRTPPSLDHVLPQCYQRVQQLQGVYHLQEPHFWTLCTDVYIGTLKLVIGPEA DARWILSQTHNIFTQAGVRQLYVQIDLAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-500 1x 500 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-100 1x 100 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details