Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 5 (CERS5)

This Recombinant Human Ceramide synthase 5 (CERS5) spans the amino acid sequence from region 1-392.

Product Specifications

Product Name Alternative

Ceramide synthase 5, CerS5, LAG1 longevity assurance homolog 5

UniProt

Q8N5B7

Expression Region

1-392

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Tryptophanyl tRNA Synthetase (WARS)
TRV-0015302-01 10 µg

Recombinant Tryptophanyl tRNA Synthetase (WARS)

Sign In for Pricing
View Details
Recombinant Tryptophanyl tRNA Synthetase (WARS)
TRV-0015302-02 50 µg

Recombinant Tryptophanyl tRNA Synthetase (WARS)

Sign In for Pricing
View Details
Recombinant Tryptophanyl tRNA Synthetase (WARS)
TRV-0015302-03 100 µg

Recombinant Tryptophanyl tRNA Synthetase (WARS)

Sign In for Pricing
View Details
Recombinant Tryptophanyl tRNA Synthetase (WARS)
TRV-0015302-04 200 µg

Recombinant Tryptophanyl tRNA Synthetase (WARS)

Sign In for Pricing
View Details
Recombinant Tryptophanyl tRNA Synthetase (WARS)
TRV-0015302-05 500 µg

Recombinant Tryptophanyl tRNA Synthetase (WARS)

Sign In for Pricing
View Details
Recombinant Tryptophanyl tRNA Synthetase (WARS)
TRV-0015302-06 1 mg

Recombinant Tryptophanyl tRNA Synthetase (WARS)

Sign In for Pricing
View Details