Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ceramide synthase 5 (CERS5)

This Recombinant Human Ceramide synthase 5 (CERS5) spans the amino acid sequence from region 1-392.

Product Specifications

Product Name Alternative

Ceramide synthase 5, CerS5, LAG1 longevity assurance homolog 5

UniProt

Q8N5B7

Expression Region

1-392

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFV RLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPF QPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVG TLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFES WEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEED VTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBPJ, NT (RBPJ, IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining binding protein suppressor of hairless, CBF-1, J kappa-recombination signal-binding protein, RBP-J kappa, Renal carcinoma antigen NY-REN-30) (MaxLight 405)
MBS6340965-01 0.1 mL

RBPJ, NT (RBPJ, IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining binding protein suppressor of hairless, CBF-1, J kappa-recombination signal-binding protein, RBP-J kappa, Renal carcinoma antigen NY-REN-30) (MaxLight 405)

Sign In for Pricing
View Details
RBPJ, NT (RBPJ, IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining binding protein suppressor of hairless, CBF-1, J kappa-recombination signal-binding protein, RBP-J kappa, Renal carcinoma antigen NY-REN-30) (MaxLight 405)
MBS6340965-02 5x 0.1 mL

RBPJ, NT (RBPJ, IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining binding protein suppressor of hairless, CBF-1, J kappa-recombination signal-binding protein, RBP-J kappa, Renal carcinoma antigen NY-REN-30) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Human B-lymphocyte antigen CD19(CD19), partial
AP78234-01 20 µg

Recombinant Human B-lymphocyte antigen CD19(CD19), partial

Sign In for Pricing
View Details
Recombinant Human B-lymphocyte antigen CD19(CD19), partial
AP78234-02 100 µg

Recombinant Human B-lymphocyte antigen CD19(CD19), partial

Sign In for Pricing
View Details
Cynomolgus Monkey Adipose Microvascular Endothelial Cells
NHP-PC058 Each

Cynomolgus Monkey Adipose Microvascular Endothelial Cells

Sign In for Pricing
View Details
OATA00545-100UG - Mouse CD45.1 Antibody
OATA00545-100UG 100 µg

OATA00545-100UG - Mouse CD45.1 Antibody

Sign In for Pricing
View Details