Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Bovine Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-392.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O77700

Expression Region

1-392

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKFII LIVWLIAAVISLPPLIYKGDQGPQPLARPQCKLNQEAWYILASSIGSFFAPCLIMILVYL RIYLIAKRSHCRGPRAKGGPGERESKQPHPVPGEVSDSAKLPTLASQLATPGEANGCSQP RPGEKGDGETPEAPGTPALPPSWPAIPKSGQGQKEGVCGSSPEEEAEEEEEEGCEPQALP ASPASACSPPLQQPQGSRVLATLRGQVLLGRGTGTAGAQWWRRRTQLSREKRFTFVLAVV IGVFVLCWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANGE 7.90- - Fire-proof safety cabinet 90 minutes tall 2 doors equipped
795-900E each

RANGE 7.90- - Fire-proof safety cabinet 90 minutes tall 2 doors equipped

Sign In for Pricing
View Details
Bet v 1, Recombinant, Birch pollen
048890 100 µg

Bet v 1, Recombinant, Birch pollen

Sign In for Pricing
View Details
Human Gas1 MAb (Clone 309325)
MAB2636-SP 25 µg

Human Gas1 MAb (Clone 309325)

Sign In for Pricing
View Details
HYOU1 Protein Lysate (Human) with C-Ha Tag
24122031 100 µg

HYOU1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CD83 Matched ELISA Antibody Pair Set, Human
MBS8118401-01 5 Plates

CD83 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
CD83 Matched ELISA Antibody Pair Set, Human
MBS8118401-02 15 Plates

CD83 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details