Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Alpha-2B adrenergic receptor (ADRA2B)

This Recombinant Bovine Alpha-2B adrenergic receptor (ADRA2B) spans the amino acid sequence from region 1-392.

Product Specifications

Product Name Alternative

Alpha-2B adrenergic receptor, Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, Alpha-2BAR

UniProt

O77700

Expression Region

1-392

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKFII LIVWLIAAVISLPPLIYKGDQGPQPLARPQCKLNQEAWYILASSIGSFFAPCLIMILVYL RIYLIAKRSHCRGPRAKGGPGERESKQPHPVPGEVSDSAKLPTLASQLATPGEANGCSQP RPGEKGDGETPEAPGTPALPPSWPAIPKSGQGQKEGVCGSSPEEEAEEEEEEGCEPQALP ASPASACSPPLQQPQGSRVLATLRGQVLLGRGTGTAGAQWWRRRTQLSREKRFTFVLAVV IGVFVLCWFPFFFSYSLGAICPQHCKVPHGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cav3.2 Antibody [DyLight 405]
NBP2-41303V 0.1 mL

Rabbit Polyclonal Cav3.2 Antibody [DyLight 405]

Sign In for Pricing
View Details
ZNF341 Antibody - N-terminal region : HRP (ARP30013_T100-HRP)
ARP30013_T100-HRP 100 µL

ZNF341 Antibody - N-terminal region : HRP (ARP30013_T100-HRP)

Sign In for Pricing
View Details
Secretogranin II, ID (Secretogranin-2, Chromogranin-C, SgII, Secretoneurin, SN, CHGC, SCG2) (MaxLight 550)
MBS6498666-01 0.1 mL

Secretogranin II, ID (Secretogranin-2, Chromogranin-C, SgII, Secretoneurin, SN, CHGC, SCG2) (MaxLight 550)

Sign In for Pricing
View Details
Secretogranin II, ID (Secretogranin-2, Chromogranin-C, SgII, Secretoneurin, SN, CHGC, SCG2) (MaxLight 550)
MBS6498666-02 5x 0.1 mL

Secretogranin II, ID (Secretogranin-2, Chromogranin-C, SgII, Secretoneurin, SN, CHGC, SCG2) (MaxLight 550)

Sign In for Pricing
View Details
FLASK RB 1 CN 24/29 & 2 ASN 14/23 I/C JT
4383C21 4 Units

FLASK RB 1 CN 24/29 & 2 ASN 14/23 I/C JT

Sign In for Pricing
View Details
Glucosamine hydrochloride
MBS3605551-01 500 mg

Glucosamine hydrochloride

Sign In for Pricing
View Details