Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ceramide synthase 4 (CERS4)

This Recombinant Bovine Ceramide synthase 4 (CERS4) spans the amino acid sequence from region 1-393.

Product Specifications

Product Name Alternative

Ceramide synthase 4, CerS4, LAG1 longevity assurance homolog 4

UniProt

Q5E9R6

Expression Region

1-393

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWSSLNDWLWNERLWLPANISWAQLEDHDGLVFPHPQDTLMAVPLALALVVVRFTFERFV ALPLSRWLGVRNQIRRPADPNATLEKHYLMKGREPTESQMNLLATQCGLTLRQTQCWFRR RRNQDRPCLTKKFCESSWKFVFYLCCFVCGTMVLYHESWLWTPVKCWENYPHQPLKPGLY HWYLLELSFYISLLMTLPFDTKRKDFKEQVIHHFVTIILISFSYSLNLLRIGSLVLLLHD SADYLLEASKLFNYMHWRRMCDTLFIIFSLVFFYTRLVLFPTRILYTTFFESIGNFSPFF GYYFLNILLVILQLLHVFWSWLILCMIYSFIKKGQMEKDVRSDVEELDSSDGEAAEECPQ MKNGAAQRPGAAPTDGPRSRAAGRMVNRHTPAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal UNG Antibody (SR1540)
NBP3-22206-50ul 50 µL

Rabbit Monoclonal UNG Antibody (SR1540)

Sign In for Pricing
View Details
SLC22A5 antibody
FNab05966 100 µg

SLC22A5 antibody

Sign In for Pricing
View Details
hsa-miR-1228 miRNA Inhibitor
MIH01096 2x 5.0 nmol

hsa-miR-1228 miRNA Inhibitor

Sign In for Pricing
View Details
JIP-2 (A-9) AC
sc-377490 AC 500 µg/mL - 25% ag

JIP-2 (A-9) AC

Sign In for Pricing
View Details
Anti-HMGN2 Antibody Picoband® (Biotine Conjugate)
A04839-2-Biotin 100 µg/Vial

Anti-HMGN2 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Lentiviral mouse Trim56 shRNA (UAS) - Lentiviral mouse Trim56 shRNA (UAS, GFP) plasmid
GTR15290350 1 Vial

Lentiviral mouse Trim56 shRNA (UAS) - Lentiviral mouse Trim56 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details