Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ceramide synthase 4 (CERS4)

This Recombinant Bovine Ceramide synthase 4 (CERS4) spans the amino acid sequence from region 1-393.

Product Specifications

Product Name Alternative

Ceramide synthase 4, CerS4, LAG1 longevity assurance homolog 4

UniProt

Q5E9R6

Expression Region

1-393

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWSSLNDWLWNERLWLPANISWAQLEDHDGLVFPHPQDTLMAVPLALALVVVRFTFERFV ALPLSRWLGVRNQIRRPADPNATLEKHYLMKGREPTESQMNLLATQCGLTLRQTQCWFRR RRNQDRPCLTKKFCESSWKFVFYLCCFVCGTMVLYHESWLWTPVKCWENYPHQPLKPGLY HWYLLELSFYISLLMTLPFDTKRKDFKEQVIHHFVTIILISFSYSLNLLRIGSLVLLLHD SADYLLEASKLFNYMHWRRMCDTLFIIFSLVFFYTRLVLFPTRILYTTFFESIGNFSPFF GYYFLNILLVILQLLHVFWSWLILCMIYSFIKKGQMEKDVRSDVEELDSSDGEAAEECPQ MKNGAAQRPGAAPTDGPRSRAAGRMVNRHTPAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces Pombe SPCC306.11 Protein (aa 24-283)
VAng-Yyj6229-500gEcoli 500 µg (E. coli)

Recombinant Schizosaccharomyces Pombe SPCC306.11 Protein (aa 24-283)

Sign In for Pricing
View Details
ZFYVE28 siRNA (h)
sc-89030 10 µM

ZFYVE28 siRNA (h)

Sign In for Pricing
View Details
Human Adipocyte Plasma Membrane Associated Protein (APMAP) ELISA Kit
DL-APMAP-Hu-01 48 Tests

Human Adipocyte Plasma Membrane Associated Protein (APMAP) ELISA Kit

Sign In for Pricing
View Details
Human Adipocyte Plasma Membrane Associated Protein (APMAP) ELISA Kit
DL-APMAP-Hu-02 96 Tests

Human Adipocyte Plasma Membrane Associated Protein (APMAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TGN46 Antibody (2F11)
H00010618-M02 0.1 mg

Mouse Monoclonal TGN46 Antibody (2F11)

Sign In for Pricing
View Details
Anti-N myc interactor/NMI Antibody Picoband® (HRP Conjugate)
PB9340-HRP 100 µg/Vial

Anti-N myc interactor/NMI Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details