Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cation channel sperm-associated protein 3 (Catsper3)

This Recombinant Mouse Cation channel sperm-associated protein 3 (Catsper3) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Cation channel sperm-associated protein 3, CatSper3

UniProt

Q80W99

Expression Region

1-395

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQHFHHNPVRVKSGSLFATASEALQARLSKIKRKDKECQAYFRKVIKSTFFQIVMITTV TTNSFLLVLGTNYDIQFEFFRTFEVSELFFVSVYVCEFLMKVYVDPITYWKDGYNILDVI ILIILTIPYLLRKIKGNHSAYLHFADGIQSLRILKLISYSRGIRTLIIAVGETVYTVASV LTLLFLLMFVFAILGFCLFGVTDRGDLENWGNLASAFFTLFSLATVDGWTDLQEELDKRK FTVSRAFTILFILLASFIFLNMFVGVMIMHTEDSMKKFERDLTLERNLAIMEEKQIILKR QQEEVNRLMNTQKSGSMNFIDMVEGFKKTLRHTDPMVLDDFSTSLSFIDIYLVTLDNQDV IVSKLQELYCEIVNVLSLMLEDMPKESSSSLSGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human HE4 (epididymal protein 4) ELISA Kit
E-UNEL-H0225-01 5x 96 Tests

Uncoated Human HE4 (epididymal protein 4) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human HE4 (epididymal protein 4) ELISA Kit
E-UNEL-H0225-02 15x 96 Tests

Uncoated Human HE4 (epididymal protein 4) ELISA Kit

Sign In for Pricing
View Details
Vmn2r21 Mouse Gene Knockout Kit (CRISPR)
KN519148 1 Kit

Vmn2r21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® N OH Resin
N30000.1G 1 g

TentaGel® N OH Resin

Sign In for Pricing
View Details
Recombinant Human PIGR Protein (Fc Tag)
PKSH032914-01 10 µg

Recombinant Human PIGR Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human PIGR Protein (Fc Tag)
PKSH032914-02 50 µg

Recombinant Human PIGR Protein (Fc Tag)

Sign In for Pricing
View Details