Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cation channel sperm-associated protein 3 (Catsper3)

This Recombinant Mouse Cation channel sperm-associated protein 3 (Catsper3) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Cation channel sperm-associated protein 3, CatSper3

UniProt

Q80W99

Expression Region

1-395

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQHFHHNPVRVKSGSLFATASEALQARLSKIKRKDKECQAYFRKVIKSTFFQIVMITTV TTNSFLLVLGTNYDIQFEFFRTFEVSELFFVSVYVCEFLMKVYVDPITYWKDGYNILDVI ILIILTIPYLLRKIKGNHSAYLHFADGIQSLRILKLISYSRGIRTLIIAVGETVYTVASV LTLLFLLMFVFAILGFCLFGVTDRGDLENWGNLASAFFTLFSLATVDGWTDLQEELDKRK FTVSRAFTILFILLASFIFLNMFVGVMIMHTEDSMKKFERDLTLERNLAIMEEKQIILKR QQEEVNRLMNTQKSGSMNFIDMVEGFKKTLRHTDPMVLDDFSTSLSFIDIYLVTLDNQDV IVSKLQELYCEIVNVLSLMLEDMPKESSSSLSGLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF640R conjugate, 0.1mg/mL
BNC403017-500 1x 500 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3017), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS640704 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Polyclonal Antibody to Human Fibronectin
RA-2701-2 2 mL

TRITC Conjugated Rabbit Polyclonal Antibody to Human Fibronectin

Sign In for Pricing
View Details
Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit
RD-EGFL6-Hu-01 96 Tests

Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit

Sign In for Pricing
View Details
Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit
RD-EGFL6-Hu-02 48 Tests

Human EGF Like Domain Protein, Multiple 6 (EGFL6) ELISA Kit

Sign In for Pricing
View Details
HLA-Pan (MHC II) (rHLA-Pan/3475), 0.2mg/mL
BNUB3475-100 1x 100 µL

HLA-Pan (MHC II) (rHLA-Pan/3475), 0.2mg/mL

Sign In for Pricing
View Details