Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Protein translocase subunit SecD (secD)

This Recombinant Methanocaldococcus jannaschii Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

Q57575

Expression Region

1-396

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDISKLLKDRKILILIIFVTLSVFLIVFKGLDFGIDLSGGTIIVLKAEKPMSDKEIEATI KIITERLNYNGLNDVVIYPRGNDEIIVEIPKSCDTDRIIKILKQQGVFVAKIDNITAYTG SDVQNVELPTKIPQGETWAYGVPFELTLEGAKKFAEVAKGKAYHKVELYMDGKLISAPVL SPDLADGKPHPQQVITVGAYPPTKEEIDEAMAIYSALKSGALPVKLDIEYISTISPEFGK EFLKGTAIALLLAFIAVGIIVSIRYKQPKIAIPILITCISEVIIILGFASLIDWKLDLPS IAGIIAAVGTGVDNQIVITDEALKRGAGKIRASIKRAFFIIFASAATSIAAMLPLFVLGV GMLKGFAITTIAGVLIGIFITRPAFARIIEEMFKKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYPL2 Human Gene Knockout Kit (CRISPR)
KN419117 1 Kit

SYPL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung: left upper lobe
CB546101 1 Block

Frozen Tissue Blocks, Lung: left upper lobe

Sign In for Pricing
View Details
Recombinant SCGN Antibody
RC-15148-01 50 μL

Recombinant SCGN Antibody

Sign In for Pricing
View Details
Recombinant SCGN Antibody
RC-15148-02 100 µL

Recombinant SCGN Antibody

Sign In for Pricing
View Details
Recombinant SCGN Antibody
RC-15148-03 1 mL

Recombinant SCGN Antibody

Sign In for Pricing
View Details
KIF3A Human Gene Knockout Kit (CRISPR)
KN421331 1 Kit

KIF3A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details