Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative transport permease yfiM (yfiM)

This Recombinant Bacillus subtilis Putative transport permease yfiM (yfiM) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Putative transport permease yfiM

UniProt

P94441

Expression Region

1-396

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKSIWIAWKDVKIRITDRKGFMMLILMPLILTCILGAALGSVVDGGSRIDDIKVGYIQS DQSDTANMFTKDVLKKMKSIKVTKVGSKDKMKKLIDEKKIDVGIVIPNHWEAGKTSAVVN AAPDQTLKSSIIETAASSFIEQYKAVKEAASGSMDYISKTEAVKQGKLDPAQFAEKLAKT LEKETGDKLTIAEKSVGSKAVTSFQYYSAAMLCMFMLFHITVGAKSFLQEKDTETLARML MTPAQKSVILFGKWLGTYLFAIIQFFIFLIVTINVFGVDWGGNLLLVSVLGLSYAAAVSG ISMLLASCISDMKTADAIGGFGIQLLAVLGGSMLPLYQFPDVLQSVSKAVPNRWALDGFL SLMEGGGWADLQKPVLLFAAIGFCSLVIGIRRLHTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6191506 1.0 µg DNA

Spata13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Triforine (Standard)
HY-B2056R 1 Each

Triforine (Standard)

Sign In for Pricing
View Details
PCDH9 Double Nickase Plasmid (m2)
sc-431761-NIC-2 20 µg

PCDH9 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Gpr172b sgRNA CRISPR Lentivector set (Mouse)
K4723101 3x 1.0 µg

Gpr172b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Botulinum neurotoxin type E (botE), partial
CSB-EP311468CLQ-01 10 µg

Recombinant Clostridium botulinum Botulinum neurotoxin type E (botE), partial

Sign In for Pricing
View Details
Recombinant Clostridium botulinum Botulinum neurotoxin type E (botE), partial
CSB-EP311468CLQ-02 50 µg

Recombinant Clostridium botulinum Botulinum neurotoxin type E (botE), partial

Sign In for Pricing
View Details