Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative transport permease yfiM (yfiM)

This Recombinant Bacillus subtilis Putative transport permease yfiM (yfiM) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Putative transport permease yfiM

UniProt

P94441

Expression Region

1-396

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKSIWIAWKDVKIRITDRKGFMMLILMPLILTCILGAALGSVVDGGSRIDDIKVGYIQS DQSDTANMFTKDVLKKMKSIKVTKVGSKDKMKKLIDEKKIDVGIVIPNHWEAGKTSAVVN AAPDQTLKSSIIETAASSFIEQYKAVKEAASGSMDYISKTEAVKQGKLDPAQFAEKLAKT LEKETGDKLTIAEKSVGSKAVTSFQYYSAAMLCMFMLFHITVGAKSFLQEKDTETLARML MTPAQKSVILFGKWLGTYLFAIIQFFIFLIVTINVFGVDWGGNLLLVSVLGLSYAAAVSG ISMLLASCISDMKTADAIGGFGIQLLAVLGGSMLPLYQFPDVLQSVSKAVPNRWALDGFL SLMEGGGWADLQKPVLLFAAIGFCSLVIGIRRLHTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PD-ECGF/Thymidine Phosphorylase Antibody (TYMP/2890R) [Alexa Fluor 700]
NBP3-08402AF700 100 µL

Rabbit Monoclonal PD-ECGF/Thymidine Phosphorylase Antibody (TYMP/2890R) [Alexa Fluor 700]

Sign In for Pricing
View Details
Lentiviral mouse Sema5a shRNA (UAS) - Lentiviral mouseSema5a shRNA (UAS, GFP) (25)
GTR15241028 1 Vial

Lentiviral mouse Sema5a shRNA (UAS) - Lentiviral mouseSema5a shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human SNED1 Pre-designed siRNA Set B
SI015410B 1 Each

Human SNED1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Polyclonal Bmf Antibody [HRP]
NBP1-76666H 0.1 mL

Rabbit Polyclonal Bmf Antibody [HRP]

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae ML1617 Protein(aa 1-80)
VAng-Yyj1536-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Leprae ML1617 Protein(aa 1-80)

Sign In for Pricing
View Details
Ubiquitin Activating Enzyme E1 (UAE E1) (PE) discontinued
U1000-09-PE 100 µL

Ubiquitin Activating Enzyme E1 (UAE E1) (PE) discontinued

Sign In for Pricing
View Details