Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative membrane protein mmpL6 (mmpL6)

This Recombinant Putative membrane protein mmpL6 (mmpL6) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Putative membrane protein mmpL6

UniProt

Q10773

Expression Region

1-397

Origin

Mycobacterium tuberculosis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQGISVTGLVKRGWMVRSVFDTIDGIDQLGEQLASVTVTLDKLAAIQPQLVALLPDEIAS QQINRELALANYATMSGIYAQTAALIENAAAMGQAFDAAKNDDSFYLPPEAFDNPDFQRG LKLFLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIYLAGTAAT FKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLVWQ HLLGIQLYWIVLALAVILLLAVGSDYNLLLISRFKEEIGAGLNTGIIRAMAGTGGVVTAA GLVFAATMSSFVFSDLRVLGQIGTTIGLGLLFDTLVVRAFMTPSIAVLLGRWFWWPQRVR PRPASRMLRPYGPRPVVRELLLREGNDDPRTQVATHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Single Donor Human Bipolar Serum
MBS8421595-01 1 Serum

Single Donor Human Bipolar Serum

Sign In for Pricing
View Details
Single Donor Human Bipolar Serum
MBS8421595-02 5x 1 Serum

Single Donor Human Bipolar Serum

Sign In for Pricing
View Details
Rabbit Anti- Desmoglein 3 Antibody IgA ELISA Kit
GTR10394704 96 Well

Rabbit Anti- Desmoglein 3 Antibody IgA ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r45 shRNA (UAS) - Lentiviral mouse Vmn1r45 shRNA (UAS) plasmid
GTR15142351 1 Vial

Lentiviral mouse Vmn1r45 shRNA (UAS) - Lentiviral mouse Vmn1r45 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CLPTM1 siRNA (Mouse)
MBS8211112-01 15 nmol

CLPTM1 siRNA (Mouse)

Sign In for Pricing
View Details
CLPTM1 siRNA (Mouse)
MBS8211112-02 30 nmol

CLPTM1 siRNA (Mouse)

Sign In for Pricing
View Details