Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecD (secD)

This Recombinant Methanothermobacter thermautotrophicus Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

O26937

Expression Region

1-403

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRKVSKFLKDYRVILLIVLVAASITAISTMGIQQGLDLQGGSLIQIQLERPVDAATMNT VTSVLDKRLNIFGVKDVKVRASGDQNVIVEIAGVQPDQVADIVGKPGKFEAKIGNETVLT GTDIVSVQPPIITGNEWEVPFRLSTDGARKFAEAARGKAGEPVKMYLDDRLITAPEISAE VATGKPVTDVRITGAENSKAEAEVQAKEIETLLKSGSLPVKVKIVGVSSVSPELGKQFAE GAVIAGLLAVLAIAVILIVRYRSPILVLPIFFTTLAELLLILGAAAVIRWNIDLAAIAGI LAAIGTGVDDQIIITDEVLSGEGRRTRRKFRIKDAFFIIFASAGTLIAAMLPLAYIGFSR GATGIGLLAGFAFTTVLGVIIGVFITRPVYARFIETFNVAGRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), 0.2mg/mL
BNUB0039-500 1x 500 µL

CD34 (ICO-115), 0.2mg/mL

Sign In for Pricing
View Details
MTFR1 (NM_001145838) Human Over-expression Lysate
LY429023 100 µg

MTFR1 (NM_001145838) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Adipose Triglyceride Lipase (PNPLA2) activation kit by CRISPRa
GA111373 1 Kit

Human Adipose Triglyceride Lipase (PNPLA2) activation kit by CRISPRa

Sign In for Pricing
View Details
Apc5 (ANAPC5) (Center) Rabbit Polyclonal Antibody
AP50172PU-N 400 µL

Apc5 (ANAPC5) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aniline Hydrochloride
TRC-A662508-1G 1 g

Aniline Hydrochloride

Sign In for Pricing
View Details
WFIKKN2 (NM_175575) Human Recombinant Protein
TP313140L 1 mg

WFIKKN2 (NM_175575) Human Recombinant Protein

Sign In for Pricing
View Details