Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1024 (MJ1024)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1024 (MJ1024) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1024

UniProt

Q58430

Expression Region

1-403

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSGDIMKLNIKKILTIGKREVLSNIKRKQFLIATIIGPLIIIALAIIGSFMMFDIKEIK VGYVDEFGLGIPNKVVENNFGKNTTIYFIKYENIEKGKEDVLNKSIDALIVIPKDYLDSG KIILYSTTKSPNPIITDTLNKFLLKKLLKGKVDNKTYNRVINPMNLEIYSVSKKGFEKET FLSQLLPIGFVFLLYMAISSLSGIIVSSIIEEKQNRIMELLLCYSSAENLMFGKILGISA VGLLQIGIWVLFALPIIITYAVKVSLYLAIFALIYFVLGYLFYSSLLCGLSSLFSHPKDA SQLISPIIIIQIIPIMFMNTIMVNPNHYMAKILSYVPFTAPYAVVLRASVTQLPLIEIVL STAIMIVSIVISFILSIKLFKIGVLLYEENLTLKRVIKIIFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSPB8 Protein (His Tag)
PKSH032525-01 10 µg

Recombinant Human HSPB8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HSPB8 Protein (His Tag)
PKSH032525-02 50 µg

Recombinant Human HSPB8 Protein (His Tag)

Sign In for Pricing
View Details
Bis(triphenylphosphine)nickel(II) Dichloride
TRC-B588700-1G 1 g

Bis(triphenylphosphine)nickel(II) Dichloride

Sign In for Pricing
View Details
ZBTB40 Antibody
8C19569-AAT 50 µg

ZBTB40 Antibody

Sign In for Pricing
View Details
HOXC6 (isoform 1) Goat Polyclonal Antibody
AP32958PU-N 100 µg

HOXC6 (isoform 1) Goat Polyclonal Antibody

Sign In for Pricing
View Details
ERK1 (MAPK3) (NM_002746) Human Over-expression Lysate
LY400968 100 µg

ERK1 (MAPK3) (NM_002746) Human Over-expression Lysate

Sign In for Pricing
View Details