Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1024 (MJ1024)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1024 (MJ1024) spans the amino acid sequence from region 1-403.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1024

UniProt

Q58430

Expression Region

1-403

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSGDIMKLNIKKILTIGKREVLSNIKRKQFLIATIIGPLIIIALAIIGSFMMFDIKEIK VGYVDEFGLGIPNKVVENNFGKNTTIYFIKYENIEKGKEDVLNKSIDALIVIPKDYLDSG KIILYSTTKSPNPIITDTLNKFLLKKLLKGKVDNKTYNRVINPMNLEIYSVSKKGFEKET FLSQLLPIGFVFLLYMAISSLSGIIVSSIIEEKQNRIMELLLCYSSAENLMFGKILGISA VGLLQIGIWVLFALPIIITYAVKVSLYLAIFALIYFVLGYLFYSSLLCGLSSLFSHPKDA SQLISPIIIIQIIPIMFMNTIMVNPNHYMAKILSYVPFTAPYAVVLRASVTQLPLIEIVL STAIMIVSIVISFILSIKLFKIGVLLYEENLTLKRVIKIIFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS633431 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Bax inhibitor 1 (TMBIM6) (NM_003217) Human Over-expression Lysate
LY418832 100 µg

Bax inhibitor 1 (TMBIM6) (NM_003217) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Fluoro Uridine
TRC-F596500-1G 1 g

5-Fluoro Uridine

Sign In for Pricing
View Details
PCDHA12 Human Gene Knockout Kit (CRISPR)
KN419790 1 Kit

PCDHA12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR563061 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
Gibberellin A34
TRC-G377370-2.5MG 2.5 mg

Gibberellin A34

Sign In for Pricing
View Details