Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas mendocina UPF0761 membrane protein Pmen_2988 (Pmen_2988)

This Recombinant Pseudomonas mendocina UPF0761 membrane protein Pmen_2988 (Pmen_2988) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

UPF0761 membrane protein Pmen_2988

UniProt

A4XWM7

Expression Region

1-405

Origin

Pseudomonas mendocina (strain ymp)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHRRLKDWLGFWLSLYQRFIENRGAGNAAALTYTTLFAVVPMMTVTFAMLSAIPAFQGVG EEIQGFIFNNFVPSTGETVQEYLREFTAQARQLTWFGVGLLAVTAFLMLVTIEKTFNVIW RVRQPRRGMSSFLLYWAILSLGPLLLGAGFAVSTYIASLSLISGPDAVVGAKTLLAFTPL LSSIAAFTLLYAAVPNTRVPLRHALLGGLFSAILFEIAKALFGLYVRLFPGYHLIYGAFA TVPLFLVWIYLSWLIVLLGAELVYGLSQPRRWRRQPLPRALILLVVLRLLLARQQKGEAL HYAEMQRGGWSLPEDEWSEVLDFLEREHLACRASGGGWVLCRDLHNFSLHQLLECSPWPL PNLSQLPAQLDEPWYPALRQALERLQNERKEQFGVSLATWLSGPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-500 1x 500 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-500 1x 500 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details