Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sebaldella termitidis Protein translocase subunit SecD (secD)

This Recombinant Sebaldella termitidis Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

D1AMK9

Expression Region

1-406

Origin

Sebaldella termitidis (strain ATCC 33386 / NCTC 11300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIKTSRIVILILVVVIPAILIFRNPINLGLDLRGGTSVVLEAQEEDGKKLQPDTMDKVR EIVQRRVDGLGVSEPVIQKSGENRLIVELAGVKDAQEAIDLIGTTAKLEFKIKTGDNSYG PTVLDGSAIKNAYVQQDQFGKPMIGFELNDEGAVKFAEITRTNMGKQLAIMLDGKEQSAP VIQSEIPGGKGSISGSFTYESAQNLANLLKAGALPVNIQIMETRSVDASLGAESIKATKM AAMIALVLVSLFMLAVYRVAGFVADLALCVFGILTAGLMCAIGTTLTLPGIAGFILSLGM AVDANVIIFERIKDEIMEGKRFQDCIDDGFNRAFPAILDGNITTLLITMVLFFFGTGPVR GFAVILTIGVLVSMFTAIFITKIIVKIFVNIFHLNGEKLFGLKGVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome c Oxidase 7A2 Conjugated Antibody
MBS9453553-01 0.1 mL (AF350)

Cytochrome c Oxidase 7A2 Conjugated Antibody

Sign In for Pricing
View Details
Cytochrome c Oxidase 7A2 Conjugated Antibody
MBS9453553-02 0.1 mL (AF405)

Cytochrome c Oxidase 7A2 Conjugated Antibody

Sign In for Pricing
View Details
Cytochrome c Oxidase 7A2 Conjugated Antibody
MBS9453553-03 0.1 mL (AF488)

Cytochrome c Oxidase 7A2 Conjugated Antibody

Sign In for Pricing
View Details
Cytochrome c Oxidase 7A2 Conjugated Antibody
MBS9453553-04 0.1 mL (AF555)

Cytochrome c Oxidase 7A2 Conjugated Antibody

Sign In for Pricing
View Details
Cytochrome c Oxidase 7A2 Conjugated Antibody
MBS9453553-05 0.1 mL (Biotin)

Cytochrome c Oxidase 7A2 Conjugated Antibody

Sign In for Pricing
View Details
IL-3 BioAssayTM ELISA Kit, Human
143918 96 Tests

IL-3 BioAssayTM ELISA Kit, Human

Sign In for Pricing
View Details