Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB)

This Recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A7HIW9

Expression Region

1-406

Origin

Anaeromyxobacter sp. (strain Fw109-5)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAASLVTLALSLSLAQAAGHAGEHGAPAPEVATPAEGHGARDAAGAATDPHGAAAEHGA AAHEDPAQHGAAGAEAGHDESLGAVMMHHVADGYVLELPGFCGGLSWACHVDLRDVFGTE HVSEIDAHGHAVERNVSGPLVFGKVDMTPTKHVVMMWIASAILLLVVFAAVRKKSLVPRG LYNFIEMLVQFVRNEIAVKNIGEKDADRFVPYLVSAFFFILFLNLFGLVPFAATATANIS VTVMMAVFTFLITQYAQIRAVGVGGYFAHMTGGVPKSLWPLWFIMIPVEFLGLFTKPFAL TVRLFANMVAGHFVILALLGLIFALNSQWIAIASVPMALSIYMLELFVAFVQAYIFTMLS SLFIGSVVAHHGHEDEHEEHGHGAAATGGAHGSHGSHVAGASPGHG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-500 1x 500 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-500 1x 500 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-100 1x 100 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-100 1x 100 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF568 conjugate, 0.1mg/mL
BNC681577-500 1x 500 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF740 conjugate, 0.1mg/mL
BNC740730-500 1x 500 µL

HSP60 (GROEL/730), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details