Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant RING finger protein 121 (rnf-121)

This Recombinant RING finger protein 121 (rnf-121) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

RING finger protein 121

UniProt

Q09251

Expression Region

1-409

Origin

Caenorhabditis elegans

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFSYFISIFTANLSPTFPCRKVNQLNYFYQLLNLKCFFRSIFKIGHFPRGSPLYLLEKS ITFSKIISIFSGHRMGQHGAIRLQNEVQEGMPPPHELTEEEQWAEEHRKMHEKHKGHEAM HMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTLIGMLTIPVYVCFNRSWYRFLATWLV FCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKLSYVLGVVGYLIMMGALLGFHVLFGV SQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMASRIGYYTPEGLPKKHLEDGVCAVCG GRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGHVFHEFCIRGWVVVGKLQTCPYCKER VDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLIVTAVQGLTTWMGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT172 siRNA Oligos set (Human)
24288171 3x 5 nmol

IFT172 siRNA Oligos set (Human)

Sign In for Pricing
View Details
ADAM33 siRNA (Mouse)
orb1838162-01 15 nmol

ADAM33 siRNA (Mouse)

Sign In for Pricing
View Details
ADAM33 siRNA (Mouse)
orb1838162-02 30 nmol

ADAM33 siRNA (Mouse)

Sign In for Pricing
View Details
GBE1 (1,4-Alpha-Glucan-Branching Enzyme, Brancher Enzyme, Glycogen-Branching Enzyme)
406491-01 50 µL

GBE1 (1,4-Alpha-Glucan-Branching Enzyme, Brancher Enzyme, Glycogen-Branching Enzyme)

Sign In for Pricing
View Details
GBE1 (1,4-Alpha-Glucan-Branching Enzyme, Brancher Enzyme, Glycogen-Branching Enzyme)
406491-02 100 µL

GBE1 (1,4-Alpha-Glucan-Branching Enzyme, Brancher Enzyme, Glycogen-Branching Enzyme)

Sign In for Pricing
View Details
RPS15AP19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2031606 1.0 µg DNA

RPS15AP19 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details