Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant RING finger protein 121 (rnf-121)

This Recombinant RING finger protein 121 (rnf-121) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

RING finger protein 121

UniProt

Q09251

Expression Region

1-409

Origin

Caenorhabditis elegans

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFSYFISIFTANLSPTFPCRKVNQLNYFYQLLNLKCFFRSIFKIGHFPRGSPLYLLEKS ITFSKIISIFSGHRMGQHGAIRLQNEVQEGMPPPHELTEEEQWAEEHRKMHEKHKGHEAM HMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTLIGMLTIPVYVCFNRSWYRFLATWLV FCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKLSYVLGVVGYLIMMGALLGFHVLFGV SQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMASRIGYYTPEGLPKKHLEDGVCAVCG GRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGHVFHEFCIRGWVVVGKLQTCPYCKER VDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLIVTAVQGLTTWMGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF713 Rabbit Polyclonal Antibody (FITC)
orb2126319 100 µL

ZNF713 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)
MBS1448270-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)
MBS1448270-02 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)
MBS1448270-03 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)
MBS1448270-04 0.1 mg (Yeast)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)
MBS1448270-05 0.02 mg (Baculovirus)

Recombinant Caenorhabditis elegans Mediator of RNA polymerase II transcription subunit 11 (mdt-11)

Sign In for Pricing
View Details