Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative metal tolerance protein C3 (MTPC3)

This Recombinant Arabidopsis thaliana Putative metal tolerance protein C3 (MTPC3) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Putative metal tolerance protein C3, AtMTPc3, AtMTP8

UniProt

Q9M2P2

Expression Region

1-411

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVNYCPETPLLSSNDHEAIDHKPKLTGMVSSMKSNFFADLPQKLRSKIDPENPLHLDVS KAAGLKEDEKEYYERQLATLKSFEEVESFLARSDEYTIDEKEEEEDRAERAAQELAMQIS NWANIFLLALKIYATVKSGSIAIAASTLDSLLDLMAGGILWFTHLSMKNVNIYKYPIGKL RVQPVGIIIFAAVMATLGFQVLLVAAEQLISNEPSEKMNHVQLIWLYSIMLSATAIKLVL WIYCKSSRNHIVRAYAKDHHFDVVTNVLGLVAAVLANAFYWWLDPTGAILLAIYTIVNWS GTVMENAVSLIGQSAPPEVLQKLTYLVMRQGGDNIKHVDTVRAYTFGVLYFVEVDIELPE DLPLKEAHAIGESLQIKLEELPEVERAFVHLDFECHHKPEHSVLSTIPNDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-100 1x 100 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-500 1x 500 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details