Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ceramide synthase 5 (Cers5)

This Recombinant Mouse Ceramide synthase 5 (Cers5) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Ceramide synthase 5, CerS5, LAG1 longevity assurance homolog 5, Translocating chain-associating membrane protein homolog 4, TRAM homolog 4

UniProt

Q9D6K9

Expression Region

1-414

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAAAETLGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSV RMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPY QPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVG ALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFES WEIIGPYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVSKDDRSDVESSSEEED ETTHKNNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFRASPHLHSCD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLPP4 Protein Lysate
OCOA15939-20UG 20 µg

PLPP4 Protein Lysate

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans sap-49 Polyclonal Antibody
MBS7187397 Inquire

Rabbit anti-Caenorhabditis elegans sap-49 Polyclonal Antibody

Sign In for Pricing
View Details
Human GRWD1 Pre-designed siRNA Set A
SI006668A 1 Each

Human GRWD1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
(2-Hydroxypropyl) -B -Cyclodextrin (Hpbcd)
1425L 00100 100 mg

(2-Hydroxypropyl) -B -Cyclodextrin (Hpbcd)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Aspartate--ammonia ligase (asnA)
MBS1150427-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum Aspartate--ammonia ligase (asnA)

Sign In for Pricing
View Details
Recombinant Treponema pallidum Aspartate--ammonia ligase (asnA)
MBS1150427-02 0.02 mg (Yeast)

Recombinant Treponema pallidum Aspartate--ammonia ligase (asnA)

Sign In for Pricing
View Details