Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ceramide synthase 5 (Cers5)

This Recombinant Mouse Ceramide synthase 5 (Cers5) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Ceramide synthase 5, CerS5, LAG1 longevity assurance homolog 5, Translocating chain-associating membrane protein homolog 4, TRAM homolog 4

UniProt

Q9D6K9

Expression Region

1-414

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAAAETLGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSV RMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPY QPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVG ALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFES WEIIGPYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVSKDDRSDVESSSEEED ETTHKNNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFRASPHLHSCD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD79A Antibody (IGA/1406) [Alexa Fluor 488]
NBP2-54370AF488 100 µL

Mouse Monoclonal CD79A Antibody (IGA/1406) [Alexa Fluor 488]

Sign In for Pricing
View Details
RNU6-19 Protein Vector (Human) (pPM-C-HA)
40439021 500 ng

RNU6-19 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Total RNA - Monkey (Rhesus) Normal Tissue: Artery
R1534013-50 50 µg

Total RNA - Monkey (Rhesus) Normal Tissue: Artery

Sign In for Pricing
View Details
PIGX siRNA (Rat)
MBS8217501-01 15 nmol

PIGX siRNA (Rat)

Sign In for Pricing
View Details
PIGX siRNA (Rat)
MBS8217501-02 30 nmol

PIGX siRNA (Rat)

Sign In for Pricing
View Details
PIGX siRNA (Rat)
MBS8217501-03 5x 30 nmol

PIGX siRNA (Rat)

Sign In for Pricing
View Details