Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis RING finger and transmembrane domain-containing protein 1 (rnft1)

This Recombinant Xenopus tropicalis RING finger and transmembrane domain-containing protein 1 (rnft1) spans the amino acid sequence from region 1-416.

Product Specifications

Product Name Alternative

RING finger and transmembrane domain-containing protein 1

UniProt

Q28GL3

Expression Region

1-416

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHRPVHERQCSTETKNWKENTQLIMQSSSGHTHHQPGSNDSPSVCMSLPVPQLSAEGSC TAGDVTIDLSSPESHHGARSSSRRVRPGNGRSLSRHGHTHSHDANGPEDANDADSREQSN SISEVFHFYKWLEKSFPYILIFSAKLVVQHITGISVGIGLLTTFLYANKCIVNQVFLRDK CSKLQCLWILVFLLFSSLLLYYTFSSQALYYSLVFMNPSLGPLHFFDALWVVGITDFIGK FFFMGLKCIILLVPSFVMSHKSKGYWYMALEEVAQCYCMLVSTPVWFRYLIDYGNQNSGA EWHFGILLALLYLILKLLIIFGQRKTSSNSLRLFLTQPNYGAAATKSQCSEVDGMCAICQ AEFIKPIVLVCQHVFCEECISLWFNKEKTCPLCRTVISNQSHKWKDGATSLQLRIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-100 1x 100 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-100 1x 100 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details