Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Verminephrobacter eiseniae UPF0761 membrane protein Veis_3782 (Veis_3782)

This Recombinant Verminephrobacter eiseniae UPF0761 membrane protein Veis_3782 (Veis_3782) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

UPF0761 membrane protein Veis_3782

UniProt

A1WPD7

Expression Region

1-417

Origin

Verminephrobacter eiseniae (strain EF01-2)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLPFSLSVAARRIEALLGDLSRFPWKTTAQTLRERFRADHLGLTASSLTFTTILALVPF FTVALAVFTAFPIFGQLQDALQGWLVSSLVPDSIARQVLGYLTQFAAKASGLGLAGFSVL LVTALALILTIDRTLNDIWRVQRLRPLGQRVLIYWAAITLGPLLLGASLALTSYVMSASG GLVKRLPDGVRFLFDSLQFMVLAAGMALLYHYVPNTPVRWRHAWSGGLFVALCIELAKKA LALYLGRVPTYSVVYGAFATLPILLVWIYMAWVIVLLGAVVTAYLPSLLAGVARRGTVAG WTFQLALEVLQQLHRVRHDAGKGLRAGQLAQLLRVDVLQLEPVLESLTALDWVGQVSAVV VAASDPPEPRYVLLADPQSTLLEPLVHKLLLERSESLGPLWDKAGLGRLQMADVLAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-100 1x 100 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details