Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidaminococcus fermentans Protein translocase subunit SecD (secD)

This Recombinant Acidaminococcus fermentans Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

D2RLC8

Expression Region

1-417

Origin

Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESKNRAKLLVSVLAIVIAFAVFIKPLVSTVKQGLDLQGGTHVVLQAQETPESKVDDDAI NRSIQIISRRVNELGLTEPVIQRQGKDKIIVELPGVKDPEQAIAMLGKTAMLEFKDMEGN TVLTGKDLKDSKASADQSGQPVVTLQFNEDGAKKFADLTARNVGRQIAILLDGKVLTAPR VSEPITGGNAQITGSKDAKEAEHLAILLRSGSLPVKLEVVENRTVGPTLGQDAKDASMKA FAIGLAGVFLFMLLYYRLSGLVADIVLLLYTLLLLAVMKGLNATLTLPGMAGIILSIGMA VDANVLIFERFKEEIANGKTLRAAVNSGFSRAFTTILDSNVTTLMAAAVLFYLGTGPIKG FAVTLALGVLISMFTAVTVTKFILGALIGSNFTKNPAWFGAKAFQPKAKDGKGEAAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triosephosphate isomerase (TPI1) (NM_000365) Human Over-expression Lysate
LY424764 100 µg

Triosephosphate isomerase (TPI1) (NM_000365) Human Over-expression Lysate

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF594 conjugate, 0.1mg/mL
BNC941786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
L-Ornithine Hydrochloride
TRC-O695550-25G 25 g

L-Ornithine Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS711784 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
Mouse ADP/Acrp30 (Adiponectin) CLIA Kit
E-CL-M0002-01 24 Tests

Mouse ADP/Acrp30 (Adiponectin) CLIA Kit

Sign In for Pricing
View Details
Mouse ADP/Acrp30 (Adiponectin) CLIA Kit
E-CL-M0002-02 48 Tests

Mouse ADP/Acrp30 (Adiponectin) CLIA Kit

Sign In for Pricing
View Details