Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidaminococcus fermentans Protein translocase subunit SecD (secD)

This Recombinant Acidaminococcus fermentans Protein translocase subunit SecD (secD) spans the amino acid sequence from region 1-417.

Product Specifications

Product Name Alternative

Protein translocase subunit SecD

UniProt

D2RLC8

Expression Region

1-417

Origin

Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESKNRAKLLVSVLAIVIAFAVFIKPLVSTVKQGLDLQGGTHVVLQAQETPESKVDDDAI NRSIQIISRRVNELGLTEPVIQRQGKDKIIVELPGVKDPEQAIAMLGKTAMLEFKDMEGN TVLTGKDLKDSKASADQSGQPVVTLQFNEDGAKKFADLTARNVGRQIAILLDGKVLTAPR VSEPITGGNAQITGSKDAKEAEHLAILLRSGSLPVKLEVVENRTVGPTLGQDAKDASMKA FAIGLAGVFLFMLLYYRLSGLVADIVLLLYTLLLLAVMKGLNATLTLPGMAGIILSIGMA VDANVLIFERFKEEIANGKTLRAAVNSGFSRAFTTILDSNVTTLMAAAVLFYLGTGPIKG FAVTLALGVLISMFTAVTVTKFILGALIGSNFTKNPAWFGAKAFQPKAKDGKGEAAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfosalicylic Acid
TRC-S699445-2.5G 2.5 g

Sulfosalicylic Acid

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD123 Antibody[6H6]
E-AB-F1117M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD123 Antibody[6H6]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD123 Antibody[6H6]
E-AB-F1117M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD123 Antibody[6H6]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD123 Antibody[6H6]
E-AB-F1117M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD123 Antibody[6H6]

Sign In for Pricing
View Details
Human Integrin Alpha 11 (ITGa11) ELISA Kit
RDR-ITGa11-Hu-01 96 Tests

Human Integrin Alpha 11 (ITGa11) ELISA Kit

Sign In for Pricing
View Details
Human Integrin Alpha 11 (ITGa11) ELISA Kit
RDR-ITGa11-Hu-02 48 Tests

Human Integrin Alpha 11 (ITGa11) ELISA Kit

Sign In for Pricing
View Details