Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME1, Human (His)

The PSME1 protein is critical for immunoproteasome assembly and is essential for efficient antigen processing. As part of the PA28 activator complex, PSME1, together with PSME2, actively enhances the production of class I binding peptides by altering the cleavage pattern of the proteasome. PSME1 Protein, Human (His) is the recombinant human-derived PSME1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PSME1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psme1-protein-human-his.html

Purity

98.0

Smiles

AMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Molecular Formula

5720 (Gene_ID) Q06323 (A2-Y249) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf114 (SPOUT1) Human qPCR Primer Pair (NM_016390)
HP212164 200 Reactions

C9orf114 (SPOUT1) Human qPCR Primer Pair (NM_016390)

Sign In for Pricing
View Details
Human Carboxypeptidase B2 (CPB2) ELISA Kit
MBS3801632-01 48 Well

Human Carboxypeptidase B2 (CPB2) ELISA Kit

Sign In for Pricing
View Details
Human Carboxypeptidase B2 (CPB2) ELISA Kit
MBS3801632-02 96 Well

Human Carboxypeptidase B2 (CPB2) ELISA Kit

Sign In for Pricing
View Details
Human Carboxypeptidase B2 (CPB2) ELISA Kit
MBS3801632-03 5x 96 Well

Human Carboxypeptidase B2 (CPB2) ELISA Kit

Sign In for Pricing
View Details
Human Carboxypeptidase B2 (CPB2) ELISA Kit
MBS3801632-04 10x 96 Well

Human Carboxypeptidase B2 (CPB2) ELISA Kit

Sign In for Pricing
View Details
CLPP Rabbit mAb
MBS9466935-01 0.05 mL

CLPP Rabbit mAb

Sign In for Pricing
View Details