Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. UPF0761 membrane protein ACIAD3168 (ACIAD3168)

This Recombinant Acinetobacter sp. UPF0761 membrane protein ACIAD3168 (ACIAD3168) spans the amino acid sequence from region 1-419.

Product Specifications

Product Name Alternative

UPF0761 membrane protein ACIAD3168

UniProt

Q6F7V8

Expression Region

1-419

Origin

Acinetobacter sp. (strain ADP1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGHYFMLNLLKKLPFYEKTWFQFILFVLRRFEADRCREHAGALTYTTLFAVVPMLTVFLV IISSIKALEPARQQLQQLIYSNFLPKSTIAFDRVLNSFTEKSSNLTVIGILFLFVTTVMM LSTIETAFNRIWRVKETRSGIIGFMRYWTIISLGPIILGSAFVISSTVASMNILSNNFAG YELSGAFILWLISFGLTILGFFILYWTIPNRTVPMYAAIIAACFSAAIFELLKNIFGFAM SNFTSYELVYGAFAAIPIFLLWIFLSWNIVLLGVEVSYALTAFHSDKIQTRHPVLMLLDV LELFYKKQKLGQSVTDLEALDIMGRGEIGRWPSYIELLEKQNLIKRTDKDEYVLVRNLSQ VDFWTFFTALPYPLPLRKDVGNIHPDDEWMQKIGPALIEADDYLAAKLSIPLSTLFEAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ran-binding protein 3-Like (RANBP3L) Mouse ELISA Kit
G6244 96 Tests

Ran-binding protein 3-Like (RANBP3L) Mouse ELISA Kit

Sign In for Pricing
View Details
Salmonella (LPS Core, Salmonella typhimurium) (MaxLight 405)
MBS6263660-01 0.1 mL

Salmonella (LPS Core, Salmonella typhimurium) (MaxLight 405)

Sign In for Pricing
View Details
Salmonella (LPS Core, Salmonella typhimurium) (MaxLight 405)
MBS6263660-02 5x 0.1 mL

Salmonella (LPS Core, Salmonella typhimurium) (MaxLight 405)

Sign In for Pricing
View Details
OR5R1 siRNA (Human)
MBS8218964-01 15 nmol

OR5R1 siRNA (Human)

Sign In for Pricing
View Details
OR5R1 siRNA (Human)
MBS8218964-02 30 nmol

OR5R1 siRNA (Human)

Sign In for Pricing
View Details
OR5R1 siRNA (Human)
MBS8218964-03 5x 30 nmol

OR5R1 siRNA (Human)

Sign In for Pricing
View Details