Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 194B (Tmem194b)

This Recombinant Rat Transmembrane protein 194B (Tmem194b) spans the amino acid sequence from region 1-421.

Product Specifications

Product Name Alternative

Transmembrane protein 194B

UniProt

P0C8N6

Expression Region

1-421

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPGSWWLVLWLPPLATLPAGAVPQEEAAMSVPRCKSLKETDLIKTSVSDCYCYNQHSQI EWTYMWSTVQVTVTSPGLLSIVYITGRHTCQHTETILSFLKCVTHNFWTAEEAKEVTIVF SPYGETVCFSVKPVGSLLTYAVSVNRNVVDFRLFLVFATGIFLFFYAKTLSQSPVFYYSS GTVLGILMTLVFVLLMTKKHIPKYSTFGALMIGCWFASVYVLCQLMENLKWLWCGNRIYV LGYVLVVGLCSFSACYSRGPPADEGSRDLLMWALRFLSLVLVYTGMAISQFAYAVMILLL LSWTRHYLLRAFSCLRWKVRQWFATRALVVRYLTDDEYREQAEAETASALEELRQACCRP DFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTESLPA S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B Polyclonal Antibody
OABB00792-100UG 100 µg/Vial

STAT5B Polyclonal Antibody

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)
MBS2144901-01 0.1 mL

Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)
MBS2144901-02 0.2 mL

Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)
MBS2144901-03 0.5 mL

Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)
MBS2144901-04 1 mL

Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)
MBS2144901-05 5 mL

Biotin-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A2 (S100A2)

Sign In for Pricing
View Details