Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. campestris UPF0761 membrane protein xcc-b100_3490 (xcc-b100_3490)

This Recombinant Xanthomonas campestris pv. campestris UPF0761 membrane protein xcc-b100_3490 (xcc-b100_3490) spans the amino acid sequence from region 1-425.

Product Specifications

Product Name Alternative

UPF0761 membrane protein xcc-b100_3490

UniProt

B0RUB3

Expression Region

1-425

Origin

Xanthomonas campestris pv. campestris (strain B100)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRVNTMHQWKERLRDRARTASFGRFLWRRFLDDRLFQAAASLAYTTVFALVPLAIVVFG VLSAFPAFNEWKDALTDFIFNNFVPGAARSVQNYLNRSLEDLGKFTVAGMVALVASLLIT LHSIEQTFNSIWRVAAARPKVTRFLIYWTVLTLGTMLAAASMAMAAYVFALPLFRTTEGQ WLAEFAWRLAPMAVEFVCIVLIYRVVPQHAVRLRHALPGALLAVILMEIVKWGFGFYLGN FQTYQRIYGALSALPILLLWIYLSWVSVLLGASLASSMSAFRYQPEAMRLPPGFEIYGLL RLLGRFRQARLHGNGLDEDRILALEPMLTDTLMQELLCELKRIRLLRRDERSNWLLARDL DVVPLAELYESCQLRVPVEDRPLPCRDDPYGQAAAAALEQLRQPLRSVLAQPVGDLYTHL PGDPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL
BNC940029-500 1x 500 µL

Fibronectin (TV-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-100 1x 100 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2965), CF594 conjugate, 0.1mg/mL
BNC942965-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2965), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details