Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C12D12.05c (SPBC12D12.05c)

This Recombinant Schizosaccharomyces pombe Uncharacterized mitochondrial carrier C12D12.05c (SPBC12D12.05c) spans the amino acid sequence from region 1-426.

Product Specifications

Product Name Alternative

Uncharacterized mitochondrial carrier C12D12.05c

UniProt

O94502

Expression Region

1-426

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTELSDITIQSVLPCDYSLFKNNLRVSRLPESRFVFSPKEEINCQSLLQGPELKTALDN LNFIHKQKFEHQFRHGYWKLHPHPHHQHDSIIPASWIHDTPHMKLVFHRLQNLPDGDLLL ENDPKNNVGYFISGGIAGIVSRTCTAPLDRLKVMLISDTGSKPSPKYPFATLLHTTKVLW NRNGIRSFFVGNGINVLKVMPESSIKFGTYEAMKRVLGISSSSENHSPLYSYLAGGMAGS VAQMFIYPVDTLKFRIQCSDLSRGQHGKSIILSNAKELYKSVGIRGYYRGVLVGILGMFP YSATDLGTFEGLKRTWIGILASRDNVDPQDVKLPNGLVMAFGALSGSTGATIVFPLNVIR TRLQTQGTSAHPATYDGFIDCFYKTTKNEGFRGLYKGLSPNLLKVAPSVAISYLVYENCK KWLGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-100 1x 100 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details