Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosospira multiformis UPF0761 membrane protein Nmul_A0452 (Nmul_A0452)

This Recombinant Nitrosospira multiformis UPF0761 membrane protein Nmul_A0452 (Nmul_A0452) spans the amino acid sequence from region 1-426.

Product Specifications

Product Name Alternative

UPF0761 membrane protein Nmul_A0452

UniProt

Q2YBW1

Expression Region

1-426

Origin

Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELFSQSSRPVAKVMKSIRPVDFMHYVLVRFFQHNCTQIAGSLTFTTLLSLVPMLAIGLS VIAAFPAFAEFSDRIKEFILTTMVPEAANKVISVYMQQFADNAAKLTAIGIAFLGVTALA LMLTIDEALNSIWRVSRLRPLLHRLLIYWSVLTIGPLLIGASLSLTSWLMTASRGFTRDI PGGDIMLLRLSPLVLTSIAFSASYLIVPNRQVAWRHAIAGGVAAAIGFEIMKEGFAFYIT RFPTYQAVYGTFATIPIFLLWLYLSWLMVLLGAVIAASLSSWRFREWRDDPNARGKQFFD ALRLLGILGEALKAGKVETALSLQQQLMLSPEEVERILELMVKANFVRQVQEGGWVQILD PAEIRIADVYRLFAFRPEALRGTAGGDTRLEQLLDDIAVGIDEKMSLPLSQLFTSAEPEP PAEMSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL
BNC880806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF568 conjugate, 0.1mg/mL
BNC681045-500 1x 500 µL

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details