Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryzias latipes Probable G-protein coupled receptor

This Recombinant Oryzias latipes Probable G-protein coupled receptor spans the amino acid sequence from region 1-428.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor

UniProt

Q91178

Expression Region

1-428

Origin

Oryzias latipes (Medaka fish) (Japanese ricefish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMADKTSPMITSDHSISNFSTGLFGPHPTVPPDVGVVTSSQSQMKDLFGLFCMVTLNLIA LLANTGVMVAIARAPHLKKFAFVCHLCAVDVLCAILLMPLGIISSSPFFGTVVFTILECQ VYIFLNVFLIWLSILTITAISVERYFYIVHPMRYEVKMTINLVIGVMLLIWFKSLLLALV TLFGWPPYGHQSSIAASHCSLHASHSRLRGVFAVLFCVICFLAPVVVIFSVYSAVYKVAR SAALQQVPAVPTWADASPAKDRSDSINSQTTIITTRTLPQRLSPERAFSGGKAALTLAFI VGQFLVCWLPFFIFHLQMSLTGSMKSPGDLEEAVNWLAYSSFAVNPSFYGLLNRQIRDEL VKFRRCCVTQPVEIGPSSLEGSFQENFLQFIQRTSSSSETHPSFANSNPRNMENQAHKIP GQIPEEQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-100 1x 100 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (8C8), CF640R conjugate, 0.1mg/mL
BNC400005-500 1x 500 µL

Bcl-2 (8C8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL
BNC682227-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details