Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 4 (Slc30a4)

This Recombinant Mouse Zinc transporter 4 (Slc30a4) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

Zinc transporter 4, ZnT-4, Lethal milk protein, Solute carrier family 30 member 4

UniProt

O35149

Expression Region

1-430

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGPGAWKRLKSLLRKDDTPLFLNDTSAFDFSDEVSDEGLSRFNKLRVVVADDDSEAPER PVNGAHPALQADDDSLLDQDLPLTNSQLSLKMDPCDNCSKRRELLKQRKVKTRLTIAAVL YLLFMIGELVGGYMANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTRRFTFGFHRLE VLSAMISVMLVYVLMGFLLYEAVQRTIHMNYEINGDVMLITAAVGVAVNVIMGFLLNQSG HHHSHAHSHSLPSNSPSMVSSGHNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKP EYKIADPICTYIFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKESLMKIEDVYSVED LNIWSLTSGKSTAIVHMQLIPGSSSKWEEVQSKAKHLLLNTFGMYKCTIQLQSYRQEVIR TCANCHSSST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serotonin Receptor 2C, Control Peptide (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C) discontinued
S1001-18P 50 µg

Serotonin Receptor 2C, Control Peptide (HTR2C, 5-hydroxytryptamine Receptor 2C, 5-HT-2C, 5-HT2C, 5-HTR2C, 5-hydroxytryptamine Receptor 1C, 5-HT-1C, 5-HT1C, HTR1C) discontinued

Sign In for Pricing
View Details
CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 405) discontinued
125512-ML405 100 µL

CXCR4 (C-X-C Chemokine Receptor Type 4, FB22, Fusin, HM89, LCR1, Leukocyte-derived Seven Transmembrane Domain Receptor, NPYRL, Stromal Cell-derived Factor 1 Receptor, CD184) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CaMKI Antibody [G24K20]
C20438-50uL 50 μL

CaMKI Antibody [G24K20]

Sign In for Pricing
View Details
NEUROD1 Rabbit Polyclonal Antibody (FITC)
orb16044 100 µL

NEUROD1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 5B (WNT5B) CLIA Kit
MBS2000578-01 24 Strip Well

Human Wingless Type MMTV Integration Site Family, Member 5B (WNT5B) CLIA Kit

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 5B (WNT5B) CLIA Kit
MBS2000578-02 48 Well

Human Wingless Type MMTV Integration Site Family, Member 5B (WNT5B) CLIA Kit

Sign In for Pricing
View Details