Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Zinc transporter 4 (Slc30a4)

This Recombinant Mouse Zinc transporter 4 (Slc30a4) spans the amino acid sequence from region 1-430.

Product Specifications

Product Name Alternative

Zinc transporter 4, ZnT-4, Lethal milk protein, Solute carrier family 30 member 4

UniProt

O35149

Expression Region

1-430

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGPGAWKRLKSLLRKDDTPLFLNDTSAFDFSDEVSDEGLSRFNKLRVVVADDDSEAPER PVNGAHPALQADDDSLLDQDLPLTNSQLSLKMDPCDNCSKRRELLKQRKVKTRLTIAAVL YLLFMIGELVGGYMANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTRRFTFGFHRLE VLSAMISVMLVYVLMGFLLYEAVQRTIHMNYEINGDVMLITAAVGVAVNVIMGFLLNQSG HHHSHAHSHSLPSNSPSMVSSGHNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKP EYKIADPICTYIFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKESLMKIEDVYSVED LNIWSLTSGKSTAIVHMQLIPGSSSKWEEVQSKAKHLLLNTFGMYKCTIQLQSYRQEVIR TCANCHSSST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ataxin-1 Rabbit Polyclonal Antibody
E53P02161 100 µL

Ataxin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ahnak2 Mouse shRNA Plasmid (Locus ID 100041194)
TL512658 1 Kit

Ahnak2 Mouse shRNA Plasmid (Locus ID 100041194)

Sign In for Pricing
View Details
SDR Antibody, HRP conjugated
CSB-PA24399B0Rb-01 50 μL

SDR Antibody, HRP conjugated

Sign In for Pricing
View Details
SDR Antibody, HRP conjugated
CSB-PA24399B0Rb-02 100 µL

SDR Antibody, HRP conjugated

Sign In for Pricing
View Details
JAKMIP2, ID (JAKMIP2, JAMIP2, KIAA0555, NECC1, Janus kinase and microtubule-interacting protein 2, CTCL tumor antigen HD-CL-04, Neuroendocrine long coiled-coil protein 1) (PE)
MBS6311542-01 0.2 mL

JAKMIP2, ID (JAKMIP2, JAMIP2, KIAA0555, NECC1, Janus kinase and microtubule-interacting protein 2, CTCL tumor antigen HD-CL-04, Neuroendocrine long coiled-coil protein 1) (PE)

Sign In for Pricing
View Details
JAKMIP2, ID (JAKMIP2, JAMIP2, KIAA0555, NECC1, Janus kinase and microtubule-interacting protein 2, CTCL tumor antigen HD-CL-04, Neuroendocrine long coiled-coil protein 1) (PE)
MBS6311542-02 5x 0.2 mL

JAKMIP2, ID (JAKMIP2, JAMIP2, KIAA0555, NECC1, Janus kinase and microtubule-interacting protein 2, CTCL tumor antigen HD-CL-04, Neuroendocrine long coiled-coil protein 1) (PE)

Sign In for Pricing
View Details