Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C18A7.02c (SPBC18A7.02c)

This Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C18A7.02c (SPBC18A7.02c) spans the amino acid sequence from region 19-457.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C18A7.02c

UniProt

Q9Y7Y9

Expression Region

19-457

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EKTLLNFKHYELCNGIYSKSESGGSLNPAIYVNWTEPWGQEDEVEVLIFNWKEIRKLGAF RSDDQFTYICDYDAVYTDHLCEADQLGLYLWNSTSAKSIRSYIIPTNADPQNIIYEISQS GYYCIWSHSKKMLPYQALVNWQNAYGGLPASQFPRMPISGGITIAYSVILALWMFFRFQY KHSIVTVQKAIMFLLIFSCAQQAVTSIVLDTENLRNRGNFTWLGETLVSILFACQLVLDL ALLLILSWGYTRYSTNMRDRLFTEAKIPLIICFFALFVVRFFAITIQSIHLGLWFCFFFL TACISALYILFGAFVALPSTLRALVEQRYYTLHSIYKIFRIMVLCGVVTIFSFSLVALIF CSNTNNNSTNKLWKIRWYFLDGWIDGVHLTYLITLSSLWRPSQENPDLDPTGLSYPVLDP RLEEELDLLEEDIRADKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
BNC940676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-500 1x 500 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL
BNC550020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-500 1x 500 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details