Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cation channel sperm-associated protein 4 (Catsper4)

This Recombinant Mouse Cation channel sperm-associated protein 4 (Catsper4) spans the amino acid sequence from region 1-442.

Product Specifications

Product Name Alternative

Cation channel sperm-associated protein 4, CatSper4

UniProt

Q8BVN3

Expression Region

1-442

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEKHKWWQQVENIDITHLGPKRKAYELLGRHEEQVLINRRDVMEKKDAWDVQEFITQMY IKQLLRHPAFQLLLAFLLLSNAITIALRTNSYLGQKHYELFSTIDDIVLTILICEVLLGW LNGFWIFWKDGWNILNFAIVFILFMGFFIKQLDMVAITYPLRVLRLVHVCMAVEPLARII KVILQSMPDLANVMALILFFMLVFSVFGVTLFGAFVPKHFQNMGVALYTLFICITQDGWL DIYTDFQMDEREYAMEVGGAIYFAVFITLGAFIGLNLFVVVVTTNLEQMMKTGEEEGHLN IKFTETEEDEDWTDELPLVHCTEARKDTSTVPKEPLVGGPLSNLTEKTCDNFCLVLEAIQ ENLMEYKEIREELNMIVEEVSSIRFNQEQQNVILHKYTSKSATFLSEPPEGANKQDLITA LVSREKVSDSNINMVNKHKFSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat HMGB-1 (High Mobility Group Protein B1) CLIA Kit
E-CL-R0348-01 24 Tests

Rat HMGB-1 (High Mobility Group Protein B1) CLIA Kit

Sign In for Pricing
View Details
Rat HMGB-1 (High Mobility Group Protein B1) CLIA Kit
E-CL-R0348-02 48 Tests

Rat HMGB-1 (High Mobility Group Protein B1) CLIA Kit

Sign In for Pricing
View Details
Rat HMGB-1 (High Mobility Group Protein B1) CLIA Kit
E-CL-R0348-03 96 Tests

Rat HMGB-1 (High Mobility Group Protein B1) CLIA Kit

Sign In for Pricing
View Details
KCTD21 (NM_001029859) Human Recombinant Protein
TP306177L 1 mg

KCTD21 (NM_001029859) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS803477 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
HMGB1 Recombinant Rabbit monoclonal Antibody [SA39-03]
ET1601-2-50UL 50 µL

HMGB1 Recombinant Rabbit monoclonal Antibody [SA39-03]

Sign In for Pricing
View Details