Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Adenylate cyclase (cya)

This Recombinant Adenylate cyclase (cya) spans the amino acid sequence from region 1-443.

Product Specifications

Product Name Alternative

Adenylate cyclase, EC= 4.6.1.1, ATP pyrophosphate-lyase, Adenylyl cyclase

UniProt

P0A4Y0

Expression Region

1-443

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAARKCGAPPIAADGSTRRPDCVTAVRTQARAPTQHYAESVARRQRVLTITAWLAVVVTG SFALMQLATGAGGWYIALINVFTAVTFAIVPLLHRFGGLVAPLTFIGTAYVAIFAIGWDV GTDAGAQFFFLVAAALVVLLVGIEHTALAVGLAAVAAGLVIALEFLVPPDTGLQPPWAMS VSFVLTTVSACGVAVATVWFALRDTARAEAVMEAEHDRSEALLANMLPASIAERLKEPER NIIADKYDEASVLFADIVGFTERASSTAPADLVRFLDRLYSAFDELVDQHGLEKIKVSGD SYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRGNPVPLRVGLATGPVVAGVVGSR RFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGKGVMRTWY LIGRKVAADPGEVRGAEPRTAGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SCUBE2 Antibody [Alexa Fluor 594]
NBP1-77186AF594 0.1 mL

Rabbit Polyclonal SCUBE2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit
MBS7262952-01 48 Well

Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit
MBS7262952-02 96 Well

Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit
MBS7262952-03 5x 96 Well

Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit
MBS7262952-04 10x 96 Well

Monkey Anti Low-Density Lipoprotein Receptor-Related Protein 4 Antibody (LRP-4-Ab) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human BLVRB, N-His
MBS1573814-01 0.1 mg

Recombinant Human BLVRB, N-His

Sign In for Pricing
View Details