Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 194A (TMEM194A)

This Recombinant Pongo abelii Transmembrane protein 194A (TMEM194A) spans the amino acid sequence from region 1-444.

Product Specifications

Product Name Alternative

Transmembrane protein 194A

UniProt

Q5RDB4

Expression Region

1-444

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGGMKVAVSPAVGPGPWGSGVGGGGTVRLLLILSGCLVYGTAEIDVNVVMLQESQVCEK RASQQFCYTNVLIPKWHDIWTRIQIRVNSSKLVRVTQVENEQKLKELEQFSIWNFFSSFL KEKLNDTYVNVGLYSTKTCLKVEIIEKDTKYSVIVIRRFDPKLFLVFLLGLMLFFCGDLL SRSQIFYYSTGMSVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQLVFKNLQ EIWRCYWQYLLSYILTVGFMSFAVCYKYGPLENERSIDLLTWTLQLMGLCFMYSGIQIPH IALAIIIIALCTKNLEYPIQWLYITYRKVCKAAEKPVPPRLLTEEEYRIQGEVETRKALE ELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIY EEASSEEEDSYSRCPAITQNNFLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C3 (C3) Rabbit Monoclonal Antibody [Clone ID: R06-2C2]
TA421495 100 µL

Complement C3 (C3) Rabbit Monoclonal Antibody [Clone ID: R06-2C2]

Sign In for Pricing
View Details
IPTG (Isopropyl-beta-D-thiogalactopyranoside), 1g
PC0708-1g 1 g

IPTG (Isopropyl-beta-D-thiogalactopyranoside), 1g

Sign In for Pricing
View Details
POTEG Mouse Monoclonal Antibody [Clone ID: OTI10E12]
CF808187 100 µg

POTEG Mouse Monoclonal Antibody [Clone ID: OTI10E12]

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), Biotin conjugate, 0.1mg/mL
BNCB1864-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1864), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GranULin (GRN) Human Gene Knockout Kit (CRISPR)
KN202139BN 1 Kit

GranULin (GRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hieff Canace™ Uracil+ High-Fidelity DNA polymerase (1 U/μL)
10145ES76 500 U

Hieff Canace™ Uracil+ High-Fidelity DNA polymerase (1 U/μL)

Sign In for Pricing
View Details