Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium phaeobacteroides UPF0761 membrane protein Cpha266_1653 (Cpha266_1653)

This Recombinant Chlorobium phaeobacteroides UPF0761 membrane protein Cpha266_1653 (Cpha266_1653) spans the amino acid sequence from region 1-449.

Product Specifications

Product Name Alternative

UPF0761 membrane protein Cpha266_1653

UniProt

A1BGZ7

Expression Region

1-449

Origin

Chlorobium phaeobacteroides (strain DSM 266)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEGIGGETLWRKEKQRPVKELIDFHMDWLHKKNEHDEWLSDRDGELYIRVFFPFFWKNF IHDKIFLSAGSLAFQSLLSLVPLLSVTLSILRVFPVFESLNRYLEDYVLQNFIPGTGTML REYLNAFIDKTSSVPLLGVVFLFIIALSLISTIDHTLNEIWEVYAPRKIVQGFTLYWTVL TLGPVLIGSSLVASSFVWYTVFTEGPLLELKTRLLSFLPFLNSVIAFFLLYMLVPNRRVR FYHAVYGSLLAAVLFELSKKWFVFYVSHFATFEYIYGALSVIPMLFFWIYLEWVVVLTGA EFVFCLGSLKPKKSISEPFDPMRGIDEILVVLGWIWEGQKTGTPLSMKSIMKKKRALQPS RARSIVDLLLQAGIVHGTANAGFAVSSDLYETTLFDLYTKIPGGFGANESETRGNGGAIL PESIGHNVTAGIKSAMTIPLATVLQDKIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-100 1x 100 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-500 1x 500 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF568 conjugate, 0.1mg/mL
BNC682284-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details